PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN04707.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 386aa    MW: 42552.7 Da    PI: 7.658
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN04707.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.47.1e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT +Ed++l+ +++++G+g+W+t +++ g++R++k+c++rw++yl
       KHN04707.1 14 KGAWTVQEDQKLITYIQKHGTGSWRTLPQKAGLKRCGKSCRLRWFNYL 61
                     79********************************************97 PP

2Myb_DNA-binding47.93e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ ++eE++ ++++ + lG++ W++Ia++++  Rt++++k++w++yl
       KHN04707.1  67 RGKLSQEEEQTIIKLRAVLGNR-WSSIAKHLP-MRTDNEIKNYWNSYL 112
                      7999******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-23564IPR009057Homeodomain-like
PROSITE profilePS5129424.514965IPR017930Myb domain
SuperFamilySSF466891.17E-2712108IPR009057Homeodomain-like
SMARTSM007172.2E-131363IPR001005SANT/Myb domain
PfamPF002491.5E-161461IPR001005SANT/Myb domain
CDDcd001672.04E-101661No hitNo description
Gene3DG3DSA:1.10.10.601.5E-2365115IPR009057Homeodomain-like
SMARTSM007174.8E-1466114IPR001005SANT/Myb domain
PROSITE profilePS5129419.12866116IPR017930Myb domain
PfamPF002493.0E-1467112IPR001005SANT/Myb domain
CDDcd001672.49E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MGRTPCCSHE ELRKGAWTVQ EDQKLITYIQ KHGTGSWRTL PQKAGLKRCG KSCRLRWFNY  60
LRPDIKRGKL SQEEEQTIIK LRAVLGNRWS SIAKHLPMRT DNEIKNYWNS YLKKQFEKNA  120
VDPSSSKPNS TDSSSESKSN DTCMVPSEKT DCHEPNTSQS HQHNLSRSIS SSTHLLNKVA  180
SKILASGYLE LIKSCQPVVA GNSKSESVVK TGIGLESDNI RDPLEPNLTS PSHSITSAKL  240
LNKMATSLPH KVHGLEAAKA VFSKLMENSE KGATASDDSF VGGCLNALSP FEDKPHITKT  300
IDSPSGPTLM FNHVTTPSCF SEDNEDNWQC VSSNYVSFKI CAANGGDCSV SEINLGESSS  360
STSSFLFENA DLGTCDDEIS KYIQYL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-29111174109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311890.0KT031189.1 Glycine max clone HN_CCL_77 MYB/HD-like transcription factor (Glyma04g33210.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003522319.10.0PREDICTED: transcription repressor MYB6-like
TrEMBLA0A0B2PAS00.0A0A0B2PAS0_GLYSO; Transcription factor MYB29
TrEMBLI1JWT00.0I1JWT0_SOYBN; MYB/HD-like transcription factor
STRINGGLYMA04G33210.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1699968
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.21e-61myb domain protein 16
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]